PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619887.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 155aa    MW: 17563.1 Da    PI: 8.1639
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619887.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601231.5e-38171161100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++r+kC+++C+la+yfp+e++++f n+hklFG+sn++k++k ++e +r++am+ l+++A+arardPv G+++++l+l++q+++++ael+
  XP_013619887.1  17 ACAACKYQRKKCTEHCILARYFPQEKQNQFLNAHKLFGVSNITKFIKGVEECQRDIAMNNLIFHANARARDPVWGVCKIMLDLKHQIACTQAELN 111
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l++++
  XP_013619887.1 112 LVHHQ 116
                     **997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575118No hitNo description
PROSITE profilePS5089123.75416117IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3517114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MSLSKFHGGS SSSSTTACAA CKYQRKKCTE HCILARYFPQ EKQNQFLNAH KLFGVSNITK  60
FIKGVEECQR DIAMNNLIFH ANARARDPVW GVCKIMLDLK HQIACTQAEL NLVHHQNLAM  120
CQTIALQQQF GCYSYGDLLE QGDEYLNIDG HVHQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619887.11e-115PREDICTED: LOB domain-containing protein 7
RefseqXP_013675601.11e-115PREDICTED: LOB domain-containing protein 7-like
SwissprotQ9SSM92e-59LBD7_ARATH; LOB domain-containing protein 7
TrEMBLA0A078CY731e-114A0A078CY73_BRANA; BnaC02g21690D protein
TrEMBLA0A0D3AQ801e-114A0A0D3AQ80_BRAOL; Uncharacterized protein
STRINGBra008062.1-P1e-96(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM154661417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.11e-52LOB domain-containing protein 7